General Information

  • ID:  hor001110
  • Uniprot ID:  NA
  • Protein name:  Peptide methionine-tyrosine
  • Gene name:  NA
  • Organism:  Petromyzon marinus
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  MPPKPDNPSPDASPELSKYMLAVRNYINLITRQRY
  • Length:  35
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001110_AF2.pdbhor001110_ESM.pdb

Physical Information

Mass: 468331 Formula: C181H288N50O53S2
Absent amino acids: CFGHW Common amino acids: P
pI: 9.74 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 8
Hydrophobicity: -86.86 Boman Index: -8180
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 69.71
Instability Index: 7549.14 Extinction Coefficient cystines: 4470
Absorbance 280nm: 131.47

Literature

  • PubMed ID:  2070789
  • Title:  Primary Structure and Conformational Analysis of Peptide Methionine-Tyrosine, a Peptide Related to Neuropeptide Y and Peptide YY Isolated From Lamprey Intestine